SAB5702296

Anti-TGF beta induced (TGFBI) Antibody, clone 7Q5O9, Rabbit Monoclonal

• Synonym(s): BIGH3, CDB1, CDG2, CDGG1, CSD, CSD1, CSD2, CSD3, EBMD, LCD1
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 7Q5O9, monoclonal
• form: liquid
• mol wt: 66 kDa
• species reactivity: human, rat, rat
• concentration: 0.19 mg/mL
• technique(s): immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: AVQKVIGTNRKYFTNCKQWYQRKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFTIFAPSNEAWAS
• UniProt accession no.: Q15582
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TGFBI(7045)

Description

General description

This gene encodes an RGD-containing protein that binds to type I, II and IV collagens. The RGD motif is found in many extracellular matrix proteins modulating cell adhesion and serves as a ligand recognition sequence for several integrins. This protein plays a role in cell-collagen interactions and may be involved in endochondrial bone formation in cartilage. The protein is induced by transforming growth factor-beta and acts to inhibit cell adhesion. Mutations in this gene are associated with multiple types of corneal dystrophy. [provided by RefSeq, Jul 2008]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TGF beta induced (TGFBI) (Q15582).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IHC

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1