HPA012693

Anti-OMG antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Synonym(s): Anti-Oligodendrocyte-myelin glycoprotein precursor
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA012693
• NACRES: NA.43

Properties

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: orthogonal RNAseq; independent; Learn more about Antibody Enhanced Validation
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:1000-1:2500
• immunogen sequence: LPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNK
• UniProt accession no.: P23515
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... OMG(4974)

Description

General description

The gene encoding oligodendrocyte-myelin glycoprotein (OMG) occupies 2.7kb of genomic DNA. It is a glycosylphosphatidyl-inositol-linked protein which is present on the plasma membrane of oligodendrocytes and neurons. OMG contains four domains - a cysteine-rich motif at the amino terminal, a series of leucine-rich repeats (LRs), a serine/threonine-rich region and a hydrophobic carboxy-terminal region.

Immunogen

Oligodendrocyte-myelin glycoprotein precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-OMG antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

Oligodendrocyte-myelin glycoprotein (OMG) is involved in cell growth regulation, inhibits neurite outgrowth and prevents axonal regeneration after brain injury. Along with two other proteins, Nogo and myelin-associated glycoprotein (MAG) it binds to the Nogo-66 receptor 1 (NgR1) to inhibit axonal growth.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71570

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable
• Personal Protective Equipment: dust mask type N95 (US), Eyeshields, Gloves