WH0057152M6

Monoclonal Anti-SLURP1 antibody produced in mouse

clone 4D1, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-ANUP, Anti-ARS, Anti-ArsB, Anti-LY6LS, Anti-MDM, Anti-secreted LY6/PLAUR domain containing 1
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4D1, monoclonal
• form: buffered aqueous solution
• species reactivity: human
• technique(s): immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• GenBank accession no.: NM_020427
• UniProt accession no.: P55000
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SLURP1(57152)

Descripción

General description

The protein encoded by this gene is a member of the Ly6/uPAR family but lacks a GPI-anchoring signal sequence. It is thought that this secreted protein contains antitumor activity. Mutations in this gene have been associated with Mal de Meleda, a rare autosomal recessive skin disorder. This gene maps to the same chromosomal region as several members of the Ly6/uPAR family of glycoprotein receptors. (provided by RefSeq)

Immunogen

SLURP1 (NP_065160, 25 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CYTCKEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCNSE

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)