WH0055607M1

Monoclonal Anti-PPP1R9A antibody produced in mouse

clone 6A10, purified immunoglobulin, buffered aqueous solution

• Sinónimos: Anti-FLJ20068, Anti-KIAA1222, Anti-NRB1, Anti-NRBI, Anti-NeurabinI, Anti-protein phosphatase 1, regulatory (inhibitor) subunit 9A
• MDL number: MFCD02263807
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 6A10, monoclonal
• form: buffered aqueous solution
• species reactivity: human, rat, mouse
• technique(s): indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG1κ
• GenBank accession no.: XM_371933
• UniProt accession no.: Q9ULJ8
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PPP1R9A(55607)

Descripción

Immunogen

PPP1R9A (XP_371933, 1090 a.a. ~ 1188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PCSTAQTSTRSPCMPFSWFNDSRKGSYSFRNLPAPTSSLQPSPETLISDKKGSKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDESLDMI

Physical form

Solution in phosphate buffered saline, pH 7.4

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: nwg
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)