Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

WH0007852M2

Sigma-Aldrich

Monoclonal Anti-CXCR4 antibody produced in mouse

clone 1F8, ascites fluid

Sinónimos:

Anti-CD184, Anti-D2S201E, Anti-FB22, Anti-HM89, Anti-HSY3RR, Anti-LAP3, Anti-LCR1, Anti-LESTR, Anti-NPY3R, Anti-NPYR, Anti-NPYRL, Anti-NPYY3R, Anti-WHIM, Anti-chemokine (C-X-C motif) receptor 4

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

ascites fluid

antibody product type

primary antibodies

clone

1F8, monoclonal

species reactivity

human

technique(s)

indirect ELISA: suitable
western blot: 1:500-1:1000

isotype

IgG1κ

GenBank accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... CXCR4(7852)

General description

This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

Immunogen

CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS

Physical form

Solution

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Hitoshi Satomura et al.
Anticancer research, 34(8), 4051-4057 (2014-07-31)
Currently, there is no effective therapy for advanced gastric cancer. In this study, we investigated whether protein expression of CXCL12 and/or its receptor CXCR4 is associated with clinicopathological features and/or survival of gastric cancer. Primary tumor specimens from patients (n=137)
Laura Barrio et al.
Cytotherapy, 16(12), 1692-1699 (2014-09-23)
Mesenchymal stromal cells hold special interest for cell-based therapy because of their tissue-regenerative and immunosuppressive abilities. B-cell involvement in chronic inflammatory and autoimmune pathologies makes them a desirable target for cell-based therapy. Mesenchymal stromal cells are able to regulate B-cell
Haralabos Papatheodorou et al.
Pathology, research and practice, 210(10), 662-667 (2014-07-22)
SDF-1/CXCR4 axis is involved in various steps of breast tumorigenesis such as tumor growth, angiogenesis and metastasis. The goal of the present study is to demonstrate in detail the immunohistochemical distribution of SDF-1 and CXCR4 in invasive breast carcinomas and
Xiaojian Liu et al.
Oncology reports, 32(6), 2760-2768 (2014-10-14)
The chemokine receptor CXCR4 and signal transducer and activator of transcription 3 (STAT3) play an important role in breast cancer malignancy and metastasis. However, it remains unknown whether STAT3 can be activated by CXCR4 in human breast cancer. The expression
Mikhal E Cohen et al.
Stem cell research, 13(2), 227-239 (2014-08-03)
Multiple sclerosis (MS) is a multifocal disease, and precursor cells need to migrate into the multiple lesions in order to exert their therapeutic effects. Therefore, cell migration is a crucial element in regenerative processes in MS, dictating the route of

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico