SAB5702409

Anti-PMP70/ABCD3 Antibody, clone 3V4K3, Rabbit Monoclonal

• Sinónimos: ABC43, CBAS5, PMP70, PXMP1, ZWS2
• UNSPSC Code: 12352203
• NACRES: NA.46

Propiedades

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 3V4K3, monoclonal
• form: liquid
• mol wt: 70 kDa
• species reactivity: rat, rat, human
• concentration: 0.75 mg/mL
• technique(s): immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: GWDSVQDWMDVLSGGEKQRMAMARLFYHKPQFAILDECTSAVSVDVEGYIYSHCRKVGITLFTVSHRKSLWKHHEYYLHMDGRGNYEFKQITEDTVEFGS
• UniProt accession no.: P28288
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... ABCD3(5825)

Descripción

General description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the ALD subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-CoAs in the organelle. All known peroxisomal ABC transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. This peroxisomal membrane protein likely plays an important role in peroxisome biogenesis. Mutations have been associated with some forms of Zellweger syndrome, a heterogeneous group of peroxisome assembly disorders. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 560-659 of human PMP70/ABCD3 (P28288).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB, IF/ICC

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1