SAB5702404

Anti-BMP15 Antibody, clone 6K5C3, Rabbit Monoclonal

• Sinónimos: GDF9B, ODG2, POF4
• UNSPSC Code: 12352203

Propiedades

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 6K5C3, monoclonal
• form: liquid
• mol wt: 50 kDa
• species reactivity: rat, human, rat
• concentration: 0.31 mg/mL
• technique(s): western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: LHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR
• UniProt accession no.: O95972
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... BMP15(9210)

Descripción

General description

This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate subunits of a disulfide-linked homodimer, or alternatively, a heterodimer, with the related protein, growth differentiation factor 9 (GDF9). This protein plays a role in oocyte maturation and follicular development, through activation of granulosa cells. Defects in this gene are the cause of ovarian dysgenesis and are associated with premature ovarian failure. [provided by RefSeq, Aug 2016]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 293-392 of human BMP15 (O95972).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1