Saltar al contenido
Merck
Todas las fotos(3)

Key Documents

SAB2102295

Sigma-Aldrich

Anti-SRC antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-ASV, Anti-C-SRC, Anti-P60-Src, Anti-SRC1, Anti-V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(3)

About This Item

MDL number:
MFCD00239655
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

60 kDa

species reactivity

guinea pig, rat, mouse, human, rabbit, bovine, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

P12931

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SRC(6714)

Immunogen

Synthetic peptide directed towards the N terminal region of human SRC

Biochem/physiol Actions

This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the malignant progression of colon cancer.

Sequence

Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nazanin Ghazanfari et al.
The Journal of physiology, 592(13), 2881-2897 (2014-05-27)
Muscle-specific kinase (MuSK) autoantibodies from myasthenia gravis patients can block the activation of MuSK in vitro and/or reduce the postsynaptic localization of MuSK. Here we use a mouse model to examine the effects of MuSK autoantibodies upon some key components
Angeles Alvarez Secord et al.
International journal of gynecological cancer : official journal of the International Gynecological Cancer Society, 24(2), 218-225 (2014-01-11)
This study aimed to explore the activity of dasatinib in combination with docetaxel, gemcitabine, topotecan, and doxorubicin in ovarian cancer cells. Cells with previously determined SRC pathway and protein expression (SRC pathway/SRC protein IGROV1, both high; SKOV3, both low) were
M Ferrandi et al.
Human molecular genetics, 23(16), 4371-4382 (2014-04-05)
Mutant α-adducin and endogenous ouabain levels exert a causal role in hypertension by affecting renal Na-K ATPase. In addition, mutant β-adducin is involved in glomerular damage through nephrin down-regulation. Recently, the salt-inducible kinase 1 (SIK1) has been shown to exert
Mattia Capulli et al.
Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research, 29(8), 1833-1846 (2014-03-13)
Chondroadherin (CHAD) is a leucine-rich protein promoting cell attachment through binding to integrin α2 β1 and syndecans. We observed that CHAD mRNA and protein were lower in bone biopsies of 50-year-old to 65-year-old osteoporotic women and in bone samples of
Steven J McElroy et al.
The American journal of pathology, 184(10), 2768-2778 (2014-09-14)
Necrotizing enterocolitis (NEC) affects up to 10% of premature infants, has a mortality of 30%, and can leave surviving patients with significant morbidity. Neuregulin-4 (NRG4) is an ErbB4-specific ligand that promotes epithelial cell survival. Thus, this pathway could be protective
Ver todos los artículos relacionados

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico