SAB2101157

Anti-IMPG2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-IPM 200, Anti-IPM200, Anti-Interphotoreceptor matrix proteoglycan 2, Anti-SPACRCAN
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 138 kDa
• species reactivity: rabbit, mouse, rat, dog, bovine, horse, human
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• UniProt accession no.: Q9BZV3
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... IMPG2(50939)

Descripción

Immunogen

Synthetic peptide directed towards the C terminal region of human IMPG2

Biochem/physiol Actions

Interphotoreceptor matrix proteoglycan-2 (IMPG2) is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in th e fundus of the eye.Interphotoreceptor matrix proteoglycan-2 is part of an extracellular complex occupying the interface between photoreceptors and the retinal pigment epithelium in the fundus of the eye.[supplied by OMIM].

Sequence

Synthetic peptide located within the following region: VVFFSLRVTNMMFSEDLFNKNSLEYKALEQRFLELLVPYLQSNLTGFQNL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable