Saltar al contenido
Merck
Todas las fotos(2)

Key Documents

SAB2100604

Sigma-Aldrich

Anti-DNAJB1 antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-DnaJ (Hsp40) homolog, subfamily B, member 1, Anti-HSPF1, Anti-Hdj1, Anti-Hsp40, Anti-Sis1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
Todas las fotos(2)

About This Item

MDL number:
MFCD02263107
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

100

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

38 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

UniProt accession no.

P25685

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DNAJB1(3337)

General description

DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) belongs to the heat shock protein 40 (HSP40) protein family. It contains a highly conserved J domain. The DNAJB1 gene is mapped to human chromosome 19p13.12.

Immunogen

Synthetic peptide directed towards the N terminal region of human DNAJB1

Application

Anti-DNAJB1 antibody produced in rabbit has been used in western blotting (1:500).

Biochem/physiol Actions

DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) interacts with heat shock protein 70 (HSP70) and can stimulate its ATPase activity. It stimulates the association between heat shock cognate 70 kDa protein (HSC70) and Hsc70-interacting protein (HIP). In association with HSP70, HSP40 favors adenosine triphosphate (ATP)-dependent protein refolding, transport, and interaction. It acts as a negative regulator melanoma differentiation-associated gene 5 (MDA5) based mitochondrial antiviral signaling protein pathway and mitogen-inducible gene 6 (MIG6). It also blocks p53 mediated apoptosis by destabilizing programmed cell death 5 (PDCD5). Hsp40 mediates viral ribonucleoproteins (vRNPs) import and may serve as a potential antiviral target.

Sequence

Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable

Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Soo-Yeon Park et al.
Biochimica et biophysica acta, 1853(10 Pt A), 2722-2730 (2015-08-05)
Mitogen-inducible gene 6 (MIG6) is a tumor suppressor implicated in the development of human cancers; however, the regulatory mechanisms of MIG6 remain unknown. Here, using a yeast two-hybrid screen, we identified DnaJ homolog subfamily B member I (DNAJB1) as a
Xiao-Ting Feng et al.
BMC developmental biology, 19(1), 9-9 (2019-04-27)
Coilia nasus oogenesis/spawning migration is a well-defined synchronous arrangement process. DnaJs are indispensable molecular chaperones for oogenesis process. However, how DnaJs involved the anadromous spawning migration mechanism is outstanding and plausible. In this regard, two DnaJs (Cn-DnaJa1 and Cn-DnaJb1) are
Hongyue Ren et al.
Oncology reports, 42(6), 2622-2634 (2019-10-30)
Cholangiocarcinoma (CCA) represents a type of epithelial cancer with a late diagnosis and poor outcome. However, the molecular mechanisms responsible for the development of CCA have not yet been fully identified. Thus, in this study, we aimed to elucidate some
Ken Takashima et al.
Journal of innate immunity, 10(1), 44-55 (2017-10-27)
Melanoma differentiation-associated gene 5 (MDA5) is a pattern recognition receptor that recognizes cytoplasmic viral double-stranded RNA (dsRNA) and initiates rapid innate antiviral responses. MDA5 forms a filament-like multimer along the dsRNA leading to oligomerization, which in turn activates the adaptor

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico