SAB1410517

Anti-GCHFR antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Sinónimos: GFRP, HsT16933, MGC138467, MGC138469, P35
• UNSPSC Code: 12352203
• NACRES: NA.41
• clone: polyclonal
• application: WB
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• citations: 2

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: antigen 9.7 kDa
• species reactivity: human
• technique(s): western blot: 1 μg/mL
• NCBI accession no.: NM_005258
• UniProt accession no.: P30047
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GCHFR(2644)

Descripción

General description

GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. (provided by RefSeq)

Immunogen

GCHFR (NP_005249.1, 1 a.a. ~ 84 a.a) full-length human protein.

Sequence
MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGFRVLSMTGVGQTLVWCLHKE

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable