SAB1405127

Monoclonal Anti-EXOSC4, (N-terminal) antibody produced in mouse

clone 4F9, purified immunoglobulin, buffered aqueous solution

• Sinónimos: FLJ20591, RRP41, RRP41A, Rrp41p, SKI6, Ski6p, hRrp41p, p12A
• UNSPSC Code: 12352203
• NACRES: NA.41
• conjugate: unconjugated
• application: ELISA (c); ELISA (i); WB
• clone: 4F9, monoclonal
• species reactivity: human
• citations: 4
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 4F9, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_019037
• UniProt accession no.: Q9NPD3
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... EXOSC4(54512)

Descripción

General description

Mouse monoclonal antibody raised against a partial recombinant EXOSC4.
The gene EXOSC4 (exosome component 4) is mapped to human chromosome 8q24.3. The encoded protein is present in the cytoplasm as well as nucleus and has a RNase pleckstrin homology (PH) domain.

Immunogen

EXOSC4 (NP_061910.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMG

Biochem/physiol Actions

EXOSC4 (exosome component 4) is a core component of the exosome complex and is required for the stability of the complex. The exosome complex exhibits 3′-5′ exoribonuclease function. EXOSC4 lacks ribonuclease activity but is involved in mRNA turnover.

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable