SAB1405057

Monoclonal Anti-PSAT1, (C-terminal) antibody produced in mouse

clone 1C2, ascites fluid

• Sinónimos: EPIP, MGC1460, PSA, PSAT
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 1C2, monoclonal
• mol wt: antigen ~38.1 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• isotype: IgG2bκ
• NCBI accession no.: NM_058179
• UniProt accession no.: Q9Y617
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PSAT1(29968)

Descripción

General description

The protein encoded by this gene is likely a phosphoserine aminotransferase, based on similarity to proteins in mouse, rabbit, and Drosophila. Alternative splicing of this gene results in two transcript variants encoding different isoforms. (provided by RefSeq)

Immunogen

PSAT1 (NP_478059, 262 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL

Physical form

Clear solution

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 11 - Combustible Solids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable