SAB1402895

Monoclonal Anti-RNASE1 antibody produced in mouse

clone 1E5, purified immunoglobulin, buffered aqueous solution

• Sinónimos: MGC12408, RIB1, RNS1
• UNSPSC Code: 12352203
• NACRES: NA.41
• conjugate: unconjugated
• application: ELISA (i)
• clone: 1E5, monoclonal
• species reactivity: human
• citations: 1
• technique(s): indirect ELISA: suitable

Propiedades

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1E5, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37 kDa
• species reactivity: human
• technique(s): indirect ELISA: suitable
• isotype: IgG2aκ
• NCBI accession no.: NM_002933
• UniProt accession no.: P07998
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RNASE1(6035)

Descripción

General description

This gene encodes a member of the pancreatic-type of secretory ribonucleases, a subset of the ribonuclease A superfamily. The encoded endonuclease cleaves internal phosphodiester RNA bonds on the 3′-side of pyrimidine bases. It prefers poly(C) as a substrate and hydrolyzes 2′,3′-cyclic nucleotides, with a pH optimum near 8.0. The encoded protein is monomeric and more commonly acts to degrade ds-RNA over ss-RNA. Alternative splicing occurs at this locus and four transcript variants encoding the same protein have been identified. (provided by RefSeq)

Immunogen

RNASE1 (NP_002924.1, 29 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KESRAKKFQRQHMDSDSSPSSSSTYCNQMMRRRNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRYPNCAYRTS

Physical form

Solution in phosphate buffered saline, pH 7.4

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable