MSST0062

SILu^™Lite APOD, Apolipoprotein D human

recombinant, expressed in HEK 293 cells, MS Protein Standard, ≥95% (SDS-PAGE)

• Sinónimos: Apo-D, ApoD
• UNSPSC Code: 23201100
• NACRES: NA.24

Propiedades

• recombinant: expressed in HEK 293 cells
• Quality Level: 200
• assay: ≥95% (SDS-PAGE)
• form: lyophilized powder
• UniProt accession no.: P05090
• shipped in: ambient
• storage temp.: −20°C
• Gene Information: human ... APOD(347)

Descripción

General description

SILu^™Lite APOD is a recombinant human protein expressed in human 293 cells. It consists of 189 amino acids (including a C-terminal polyhistidine tag), with a calculated molecular mass of 21.69 kDa. SILu^™Lite APOD is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Biochem/physiol Actions

Apolipoprotein D is a member of the Apolipoprotein family. Unlike other lipoproteins, which are mainly produced in the liver, apolipoprotein D is mainly produced in the brain and testes. It was found to be a putative biomarker of androgen receptor function in androgen insensitivity syndrome, the most common cause of disorders of sex development. Apolipoprotein D is associated with neurological disorders and nerve injury, especially related to myelin sheath. It was shown to be elevated in a rat model of stroke, and is elevated in patients with schizophrenia, bipolar disorder, and Alzheimer′s disease.

Sequence

QAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLSDYKDDDDKGHHHHHHHHGGQ

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Información de seguridad

• Storage Class: 11 - Combustible Solids
• wgk_germany: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable