MSST0006

SILu^™Lite VEGFA Vascular endothelial growth factor A human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Sinónimos: SILuLite Vascular endothelial growth factor A
• UNSPSC Code: 23201100
• NACRES: NA.12

Propiedades

• biological source: human
• Quality Level: 200
• recombinant: expressed in HEK 293 cells
• assay: ≥98% (SDS-PAGE)
• form: lyophilized powder
• technique(s): mass spectrometry (MS): suitable
• UniProt accession no.: P15692
• storage temp.: −20°C
• Gene Information: human ... VEGFA(7422)

Descripción

General description

SILu^™ Lite VEGF165 is a recombinant glycosylated human protein expressed in human 293 cells. It is a homodimer with an apparent molecular mass of 45 kDa.


Suggested Quantitative Analysis Parameters
(MRM settings provided for three suggested peptides)

Biochem/physiol Actions

VEGF165 belongs to the PDGF/VEGF growth factor family characterized by the presence of eight conserved cysteine residues and a cystine knot structure.¹ VEGF is secreted by the majority of tumor cells and initiates angiogenesis by activating endothelial cells of existing blood vessels and promoting their migration.²
VEGF has also been implicated in correlation with poor prognosis in breast cancer.² In addition, VEGF is released in rheumatoid arthritis in response to TNF-α, increasing endothelial permeability and stimulating angiogenesis (formation of capillaries)^3,4

Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGC

Physical form

Supplied as a lyophilized powder containing phosphate buffered saline

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Información de seguridad

• Storage Class: 11 - Combustible Solids
• wgk_germany: WGK 2
• flash_point_f: Not applicable
• flash_point_c: Not applicable