HPA040913
Anti-MGME1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Sinónimos:
Anti-C20orf72, Anti-Chromosome 20 open reading frame 72, Anti-bA504H3.4
Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización
About This Item
UNSPSC Code:
12352203
Human Protein Atlas Number:
Productos recomendados
biological source
rabbit
Quality Level
conjugate
unconjugated
antibody form
affinity isolated antibody
antibody product type
primary antibodies
clone
polyclonal
product line
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
technique(s)
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
immunogen sequence
NLVQSVLSSRGVAQTPGSVEEDALLCGPVSKHKLPNQGEDRRVPQNWFPIFNPERSDKPNASDPSVPLKIPLQRNVIPSVTRVL
shipped in
wet ice
storage temp.
−20°C
target post-translational modification
unmodified
Gene Information
human ... C20orf72(92667)
Categorías relacionadas
General description
Mitochondrial genome maintenance exonuclease 1 (MGME1) is encoded by the gene mapped to human chromosome 20p11.23. The encoded protein is a member of PD-(D/E) XK nuclease superfamily. MGME1 is a homologue of the bacterial RecB nuclease involved in DNA recombination.
Immunogen
chromosome 20 open reading frame 72 recombinant protein epitope signature tag (PrEST)
Application
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
Biochem/physiol Actions
Mitochondrial genome maintenance exonuclease 1 (MGME1) acts as a mitochondrial DNA nuclease and has an ability to cleave DNA with a free end. Loss or mutation in the gene leads to mitochondrial DNA (mtDNA) depletion, deletions, duplications and rearrangements and is also associated with mitochondrial diseases. The encoded protein is also involved in intramolecular recombination of mitochondrial DNA (mtDNA) and in 7S DNA turnover.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Linkage
Corresponding Antigen APREST83094
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
¿No encuentra el producto adecuado?
Pruebe nuestro Herramienta de selección de productos.
Storage Class
10 - Combustible liquids
wgk_germany
WGK 1
flash_point_f
Not applicable
flash_point_c
Not applicable
Certificados de análisis (COA)
Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»
¿Ya tiene este producto?
Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.
MGME1 processes flaps into ligatable nicks in concert with DNA polymerase ? during mtDNA replication
Uhler J P
Nucleic Acids Research, 44(12), 5861-5871 (2016)
Thomas J Nicholls et al.
Human molecular genetics, 23(23), 6147-6162 (2014-07-06)
MGME1, also known as Ddk1 or C20orf72, is a mitochondrial exonuclease found to be involved in the processing of mitochondrial DNA (mtDNA) during replication. Here, we present detailed insights on the role of MGME1 in mtDNA maintenance. Upon loss of
Yanan Luan et al.
Journal of cellular biochemistry, 122(1), 16-28 (2020-09-24)
Long noncoding RNAs (lncRNAs), a group of transcripts, have been revealed to be critical participants in regulating multiple biological processes of malignant tumors. The knowledge of NPPA-AS1 (a new lncRNA) in cancer research is hardly known. Thus, it is of
Roman J Szczesny et al.
Nucleic acids research, 41(5), 3144-3161 (2013-01-30)
Although the human mitochondrial genome has been investigated for several decades, the proteins responsible for its replication and expression, especially nucleolytic enzymes, are poorly described. Here, we characterized a novel putative PD-(D/E)XK nuclease encoded by the human C20orf72 gene named
Cornelia Kornblum et al.
Nature genetics, 45(2), 214-219 (2013-01-15)
Known disease mechanisms in mitochondrial DNA (mtDNA) maintenance disorders alter either the mitochondrial replication machinery (POLG, POLG2 and C10orf2) or the biosynthesis pathways of deoxyribonucleoside 5'-triphosphates for mtDNA synthesis. However, in many of these disorders, the underlying genetic defect has
Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.
Póngase en contacto con el Servicio técnico