HPA024802

Anti-SLC19A1 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-FOLT, Anti-solute carrier family 19 (folate transporter), member 1
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA024802
• NACRES: NA.41

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• immunogen sequence: AQALSVQDKGLGGLQPAQSPPLSPEDSLGAVGPASLEQRQSDPYLAQAPAPQAAEFLSPVTTPSPCTLCSAQASGPEAADETCPQLAVHPPGVSKLGLQCLPSDGVQNV
• UniProt accession no.: P41440
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... SLC19A1(6573)

Descripción

General description

The gene SLC19A1 (solute carrier family 19 member 1) is mapped to human chromosome 21q22. It is expressed in many tissues, mainly enterocytes and hepatocytes.

Immunogen

solute carrier family 19 (folate transporter), member 1 recombinant protein epitope signature tag (PrEST)

Application

Anti-SLC19A1 antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

At physiological pH, SLC19A1 (solute carrier family 19 member 1) is involved in the transfer of reduced folates into the cells. It is also involved in the uptake of the antifolate methotrexate. In osteosarcoma and neuroblastoma, decrease in the activity of SLC19A1 leads to methotrexate resistance. In patients with colorectal cancer, high expression of SLC19A1 reduces risk of recurrent disease (disease-free survival). SLC19A1 might be linked with non-syndromic cleft lip and palate and neural tube defects. Additionally, mutations in SLC19A1 gene are associated with risk of ischemic stroke.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST73240

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable