HPA014044

Anti-CLEC4G antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-C-type lectin domain family 4 member G
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA014044
• NACRES: NA.43

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• enhanced validation: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technique(s): immunohistochemistry: 1:50- 1:200
• immunogen sequence: QGFLTRNTRGRGYWLGLRAVRHLGKVQGYQWVDGVSLSFSHWNQGEPNDAWGRENCVMMLHTGLWNDAPCDSEKDGWICEKR
• UniProt accession no.: Q6UXB4
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... CLEC4G(339390)

Descripción

General description

The gene CLEC4G (C-type lectin domain family 4 member G) gene forms a lectin gene cluster at human chromosome 19p13.3 along with DC-SIGN, and L-SIGN and CD23. CLEC4G is expressed on sinusoidal endothelial cells in liver and lymph nodes along with DC-SIGNR. The C-type lectins contain a C-terminal carbohydrate recognition domain (CRD) that functions as an attachment factor. This domain links high mannose oligosaccharides or N-linked glycosylated protein. The neck region of CRD contains repeat units called the VNTR (variable number tandem repeat).

Immunogen

C-type lectin domain family 4 member G recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

The C-type lectin encoded by the gene CLEC4G (C-type lectin domain family 4 member G) plays an important role in the activation of B-cells. It interacts with and mediates viral and bacterial pathogen recognitions. The human CLEC4G protein was previously referred to as LSECtin. It is capable of interacting with BACE1 (β-Site amyloid precursor protein cleaving enzyme-1 ) molecule and negatively regulate it. BACE1 cleaves amyloid precursor protein (APP) to form toxic amyloid-β (Aβ) peptides and has been implicated in Alzheimer′s disease (AD).

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72322

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)