HPA002044

Anti-PSMC4 antibody produced in rabbit

Ab1, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-26S protease regulatory subunit 6B antibody produced in rabbit, Anti-MB67-interacting protein antibody produced in rabbit, Anti-MIP224 antibody produced in rabbit, Anti-Proteasome 26S subunit ATPase 4 antibody produced in rabbit, Anti-TAT-binding protein 7 antibody produced in rabbit, Anti-TBP-7 antibody produced in rabbit
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA002044

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: mouse, rat, human
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• immunogen sequence: LEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNA
• UniProt accession no.: P43686
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PSMC4(5704)

Descripción

General description

PSMC4 (proteasome 26S subunit, ATPase 4) is a member of the 26S proteasomal ATPase family. The 26S proteasome is an ATP-dependent dumbbell-shaped protease. It is approximately 2000kDa multisubunit complex, with a central catalytic 20S proteasome and two V-shaped regulatory modules, named PA700. PA700 is further sub divided into two groups: one with six ATPases that makes a unique multi-gene family and another with 15 non-ATPase subunits.

Immunogen

26S protease regulatory subunit 6B recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biochem/physiol Actions

PSMC4 (proteasome 26S subunit, ATPase 4) is mainly involved in catalyzing degradation of polyubiquitinated proteins via ubiquitin-dependent proteolysis. It helps in turnover of both short and long lived proteins. It has been reported that it interacts with MB67, an orphan member of the nuclear hormone receptor superfamily. The central catalytic portion participates in degradation of small peptides and fully denatured small proteins in an ATP-independent manner.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST86557

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)