HPA002027

Anti-MBL2 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinónimos: Anti-MBP-C antibody produced in rabbit, Anti-MBP1 antibody produced in rabbit, Anti-Mannan-binding protein antibody produced in rabbit, Anti-Mannose-binding lectin antibody produced in rabbit, Anti-Mannose-binding protein C precursor antibody produced in rabbit
• UNSPSC Code: 12352203
• Human Protein Atlas Number: HPA002027
• NACRES: NA.41

Propiedades

• biological source: rabbit
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• product line: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• species reactivity: human
• technique(s): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:200-1:500
• immunogen sequence: DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
• UniProt accession no.: P11226
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... MBL2(4153)

Descripción

General description

MBL2 (mannose binding lectin 2) is a mannose-binding protein, expressed in neurons, astrocytes, microglia and belongs to the collectins family. It has also been found in oligodendrocytes of the frontal cortex of the HIV (human immunodeficiency virus)-1 infected brain.

Immunogen

Mannose-binding protein C precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-MBL2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

MBL2 (mannose binding lectin 2) is associated with the activation of complement pathway, pathogen opsonization, chemotaxis, and activation of leukocytes and phagocytosis. Deficiency of MBL leads to to HIV (human immunodeficiency virus) transmission and disease progression. In bloodstream, it binds to the mannose residues or carbohydrates on pathogens such as bacteria, yeast, viruses, or parasites which helps to activate lectin complement pathway. With the help of two serine proteases, MBL-associated serine proteases (MASP-1 and MASP-2), MBL activates the complement factors C4 and C2 through a novel pathway.

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST78225

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 1
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)