Saltar al contenido
Merck

HPA001562

Sigma-Aldrich

Anti-ATF3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Sinónimos:

ATF3 Antibody - Anti-ATF3 antibody produced in rabbit, Atf3 Antibody, Anti-Activating transcription factor 3 antibody produced in rabbit, Anti-Cyclic AMP-dependent transcription factor ATF-3 antibody produced in rabbit

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

MDL number:
UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

enhanced validation

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

technique(s)

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500

immunogen sequence

MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTEC

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ATF3(467)

General description

Activating transcription factor 3 (ATF3) gene is mapped to human chromosome 1q32.3. The encoded protein belongs to the cAMP-response element binding (CREB) protein family.
Rabbit polyclonal anti-ATF3 antibody reacts with human activating transcription factor 3.

Immunogen

Cyclic AMP-dependent transcription factor ATF-3 recombinant protein epitope signature tag (PrEST)

Application

Anti-ATF3 antibody produced in rabbit has been used in:
  • western blotting
  • immunofluorescence
  • immunohistochemical staining
  • chromatin immunoprecipitation (ChIP)

Biochem/physiol Actions

Activating transcription factor 3 (ATF3), a cyclic AMP-dependent transcription factor stimulates transcription by sequestering inhibitory cofactors. ATF3 responds to stress signals and is involved in the regulation of immune and metabolic homeostasis. It helps to prevent chronic inflammation and starvation responses. ATF3 expression is induced in response to eye injury. It serves as a marker for neuronal injury.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST77475

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

ppe

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

A potential dichotomous role of ATF3, an adaptive-response gene, in cancer development
Yin X, et al.
Oncogene, 27(15), 2118-2118 (2008)
Tsonwin Hai et al.
Methods in enzymology, 490, 175-194 (2011-01-27)
Activating transcription factor 3 (ATF3) gene encodes a member of the ATF family of transcription factors and is induced by various stress signals, including many of those that induce the unfolded protein response (UPR). Emerging evidence suggests that ATF3 is
Gurdeep Marwarha et al.
Journal of Alzheimer's disease : JAD, 57(3), 907-925 (2017-03-18)
Epidemiological studies implicate diets rich in saturated free fatty acids (sFFA) as a potential risk factor for developing Alzheimer's disease (AD). In particular, high plasma levels of the sFFA palmitic acid (palmitate) were shown to inversely correlate with cognitive function.
Marta Bueno et al.
Aging cell, 17(2) (2018-01-25)
PINK1 (PTEN-induced putative kinase 1) is a key regulator of mitochondrial homeostasis that is relatively depleted in aging lungs and in lung epithelial cells from patients with idiopathic pulmonary fibrosis (IPF), a disease linked with aging. Impaired PINK1 expression and
Activating transcription factor 3 promotes embryo attachment via up-regulation of leukemia inhibitory factor in vitro
Cheng X, et al.
Reproductive Biology and Endocrinology, 15(1), 42-42 (2017)

Global Trade Item Number

Número de referencia del producto (SKU)GTIN
HPA001562-100UL4061837132940
HPA001562-25UL4061842773282

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico