AV49064

Anti-TMTC2 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-DKFZp762A217, Anti-Transmembrane and tetratricopeptide repeat containing 2
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 94 kDa
• species reactivity: horse, bovine, human, rat, dog, guinea pig, mouse
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_689801
• UniProt accession no.: Q8N394
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... TMTC2(160335)

Descripción

Immunogen

Synthetic peptide directed towards the N terminal region of human TMTC2

Application

Anti-TMTC2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Biochem/physiol Actions

Transmembrane and tetratricopeptide repeat containing 2 (TMTC2) is tetratricopeptide repeats (TPR)-containing integral membrane adapter protein present in the endoplasmic reticulum (ER). TMTC1 and TMTC2 bind the carbohydrate-binding chaperone calnexin and regulate calcium homeostasis in the ER.

Sequence

Synthetic peptide located within the following region: SNSDNPAADSDSLLTRTLTFFYLPTKNLWLLLCPDTLSFDWSMDAVPLLK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable