AV48378

Anti-OCIAD1 antibody produced in rabbit

affinity isolated antibody

• Sinónimos: Anti-Asrij, Anti-FLJ20455, Anti-MGC111072, Anti-OCIA, Anti-OCIA domain containing 1, Anti-TPA018
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: affinity isolated antibody
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 27 kDa
• species reactivity: guinea pig, horse, human, rat
• concentration: 0.5 mg - 1 mg/mL
• technique(s): western blot: suitable
• NCBI accession no.: NP_001073308
• UniProt accession no.: Q9NX40
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... OCIAD1(54940)

Descripción

General description

OCIAD1 codes for an OCIA domain-containing protein that is involved in ovarian cancer cell adhesion. Its expression in differentiated thyroid carcinoma has been correlated to metastasis risk.
Rabbit Anti-OCIAD1 antibody recognizes canine, bovine, human, mouse, and rat OCIAD1.

Immunogen

Synthetic peptide directed towards the C terminal region of human OCIAD1

Application

Rabbit Anti-OCIAD1 antibody is suitable for western blot applications at a concentration of 1μg/ml.

Biochem/physiol Actions

OCIAD1 belongs to the OCIAD1 family. It contains 1 OCIA domain. OCIAD1 is over-expressed in metastatic ovarian cancer. Effect of OCIAD1 on cell adhesion may be related to its function in ovarian cancer. Possibily, OCIAD1 may play a role in tumor metastasis.

Sequence

Synthetic peptide located within the following region: QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable