AV46626

Anti-RTN2 antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-NSP2, Anti-NSPL1, Anti-Reticulon 2
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 51 kDa
• species reactivity: human, rat, pig, horse, mouse, bovine, dog
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_996783
• UniProt accession no.: A8K7F2
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... RTN2(6253)

Descripción

Immunogen

Synthetic peptide directed towards the N terminal region of human RTN2

Application

Anti-RTN2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Biochem/physiol Actions

RTN2 (reticulon 2) gene also referred to as NSP2 or NSPL1 is a member of reticulon encoding gene family. It plays a pivotal role in organizing endoplasmic reticulum and distal motor axons. RTN2B, isoform of RTN2 regulates the trafficking as well as facilitates as a positive modulator for delivering the EAAC1 (excitatory amino acid carrier 1) from ER to the cell surface. Mutation in RTN2 gene leads to axon-degenerative disorder hereditary spastic paraplegia type 12.

Sequence

Synthetic peptide located within the following region: MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable