Saltar al contenido
Merck
Todas las fotos(2)

Key Documents

AV44694

Sigma-Aldrich

Anti-MPG antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-AAG, Anti-APNG, Anti-CRA36.1, Anti-MDG, Anti-Mid1, Anti-N-Methylpurine-DNA glycosylase, Anti-PIG11, Anti-PIG16

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

32 kDa

species reactivity

rat, mouse, human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... MPG(4350)

Immunogen

Synthetic peptide directed towards the C terminal region of human MPG

Application

Anti-MPG antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Biochem/physiol Actions

N-methylpurine-DNA glycosylase (MPG) is an enzyme that repairs the genome-wide damage caused by alkylating agents. MPG repairs the hypoxanthine that is formed by the deamination of adenine and 1,N6-ethenoadenine formed as a result of interaction of lipid peroxidation-derived aldehydes and hydroxyalkenals with DNA. A functional linkage between MPG and p53; MPG acting as the selective regulator of p53-mediated cell cycle arrest.

Sequence

Synthetic peptide located within the following region: LEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGSPWVSVVDRVAEQDTQA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Robyn L Maher et al.
DNA repair, 6(1), 71-81 (2006-10-05)
The base excision repair pathway removes damaged DNA bases and resynthesizes DNA to replace the damage. Human alkyladenine DNA glycosylase (AAG) is one of several damage-specific DNA glycosylases that recognizes and excises damaged DNA bases. AAG removes primarily damaged adenine
Yael Leitner-Dagan et al.
Journal of the National Cancer Institute, 104(22), 1765-1769 (2012-10-30)
Only a minority of smokers develop lung cancer, possibly due to genetic predisposition, including DNA repair deficiencies. To examine whether inter-individual variations in DNA repair activity of N-methylpurine DNA glycosylase (MPG) are associated with lung cancer, we conducted a blinded
Shanshan Song et al.
Cell research, 22(8), 1285-1303 (2012-07-18)
Alkylating agents induce genome-wide base damage, which is repaired mainly by N-methylpurine DNA glycosylase (MPG). An elevated expression of MPG in certain types of tumor cells confers higher sensitivity to alkylation agents because MPG-induced apurinic/apyrimidic (AP) sites trigger more strand
Chun-Yue I Lee et al.
Biochemistry, 48(9), 1850-1861 (2009-02-18)
The human 3-methyladenine DNA glycosylase (AAG) recognizes and excises a broad range of purines damaged by alkylation and oxidative damage, including 3-methyladenine, 7-methylguanine, hypoxanthine (Hx), and 1,N(6)-ethenoadenine (epsilonA). The crystal structures of AAG bound to epsilonA have provided insights into

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico