Saltar al contenido
Merck
Todas las fotos(3)

Key Documents

AV40721

Sigma-Aldrich

Anti-HNRPH3 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Heterogeneous Nuclear Ribonucleoprotein H3 (2H9)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

38 kDa

species reactivity

guinea pig, bovine, rabbit, rat, human, horse, mouse, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... HNRPH3(3189)

General description

Heterogeneous Nuclear Ribonucleoproteins (hnRNP) are RNA binding proteins that form complexes with heterogeneous nuclear RNA (hnRNA). HnRNPs regulate pre-mRNA processing, metabolism and nuclear cytoplasmic shuttling. Specific HnRNPs have unique nucleic acid binding properties. Heterogeneous Nuclear Ribonucleoprotein H3 has been identified as an autoantigen for acute anterior uveitis. Heterogeneous Nuclear Ribonucleoprotein H3 may be involved in pre-mRNA splicing associated with inflammatory bowel disease (IBD).

Specificity

Anti-HNRPH3 polyclonal antibody reacts with canine, chicken, zebrafish, human, mouse, rat, and bovine Heterogeneous Nuclear Ribonucleoprotein H3 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human HNRPH3

Application

Anti-HNRPH3 polyclonal antibody is used to tag the heterogeneous nuclear ribonucleoprotein H3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of heterogeneous nuclear ribonucleoprotein 3 in diseases such as acute anterior uveitis and inflammatory bowel disease (IBD).

Biochem/physiol Actions

HNRPH3 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein has two repeats of quasi-RRM domains that bind to RNAs. It is localized in nuclear bodies of the nucleus. This protein is involved in the splicing process and it also participates in early heat shock-induced splicing arrest by transiently leaving the hnRNP complexes.This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. It is localized in nuclear bodies of the nucleus. This protein is involved in the splicing process and it also participates in early heat shock-induced splicing arrest by transiently leaving the hnRNP complexes. Multiple alternative transcript variants seem to be present for this gene and some appear to have intronic regions in the mRNA. Presently, only two transcript variants are fully described.

Sequence

Synthetic peptide located within the following region: DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico