Saltar al contenido
Merck
Todas las fotos(1)

Documentos clave

AV38012

Sigma-Aldrich

Anti-BACH1 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-BTB and CNC homology 1, basic leucine zipper transcription factor 1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

82 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... BACH1(571)

General description

BTB-basic leucine zipper transcription factor is a member of a novel family of broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) basic region leucine zipper factors.
Bach1 functions as transcription repressor in transfection assays using fibroblast cells and as a transcriptional activator and repressor, respectively, in cultured erythroid cells. Bach1 is involved in the coordination of transcription activation and repression by Maf family members such as MafK. Bach1 (BTB and CNC homology 1, basic leucine zipper transcription factor 1) inhibits oxidative stress-inducible genes and is a negative regulator of oxidative stress-induced cellular senescence.

Specificity

Anti-BACH1 antibody reacts with human BTB and CNC homology 1, basic leucine zipper transcription factor 1 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human BACH1

Application

Anti-BACH1 antibody is used to tag BTB and CNC homology 1, basic leucine zipper transcription factor 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of basic leucine zipper transcription factor 1 in the regulation of processes such as cellular response to oxidative stress.

Biochem/physiol Actions

BACH1 is a transcription factor that belongs to the cap′n′collar type of basic region leucine zipper factor family (CNC-bZip). The encoded protein contains broad complex, tramtrack, bric-a-brac/poxvirus and zinc finger (BTB/POZ) domains, which is atypical of CNC-bZip family members. These BTB/POZ domains facilitate protein-protein interactions and formation of homo- and/or hetero-oligomers. When this encoded protein forms a heterodimer with MafK, it functions as a repressor of Maf recognition element (MARE) and transcription is repressed. Multiple alternatively spliced transcript variants have been identified for this gene. Some exons of this gene overlap with some exons from the C21orf41 gene, which is transcribed in an opposite orientation to this gene but does not seem to encode a protein.

Sequence

Synthetic peptide located within the following region: PPCARGNSEPGYARGQESQQMSTATSEQAGPAEQCRQSGGISDFCQQMTD

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 1

flash_point_f

Not applicable

flash_point_c

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Naoki Mine et al.
Molecular cancer therapeutics, 13(9), 2215-2225 (2014-07-24)
CBP501 is an anticancer drug candidate that was investigated in two randomized phase II clinical trials for patients with nonsquamous non-small cell lung cancer (NSCLC) and malignant pleural mesothelioma (MPM). CBP501 has been shown to have two mechanisms of action

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico