AV34981

Anti-GABRA3 (AB1) antibody produced in rabbit

IgG fraction of antiserum

• Sinónimos: Anti-γ-Aminobutyric acid (GABA) A receptor, α 3
• UNSPSC Code: 12352203
• NACRES: NA.41

Propiedades

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 55 kDa
• species reactivity: mouse, guinea pig, horse, human, rabbit, dog, rat, bovine
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_000799
• UniProt accession no.: P34903
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... GABRA3(2556)

Descripción

General description

GABRA3 codes for the GABA_A receptor α3 subunit. Genetic varaiations in GABRA3 have been linked to behavioural despair, bipolar affective disorders and thyrotoxic hypokalaemic periodic paralysis.
Rabbit Anti-GABRA3 antibody recognizes bovine, human, mouse, rat, and canine GABRA3.

Immunogen

Synthetic peptide directed towards the middle region of human GABRA3

Application

Rabbit Anti-GABRA3 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified.

Sequence

Synthetic peptide located within the following region: AEVVYSWTLGKNKSVEVAQDGSRLNQYDLLGHVVGTEIIRSSTGEYVVMT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Información de seguridad

• Storage Class: 10 - Combustible liquids
• wgk_germany: WGK 3
• flash_point_f: Not applicable
• flash_point_c: Not applicable