Saltar al contenido
Merck
Todas las fotos(3)

Documentos clave

AV32303

Sigma-Aldrich

Anti-FOXL1 antibody produced in rabbit

IgG fraction of antiserum

Sinónimos:

Anti-Forkhead box L1

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

36 kDa

species reactivity

bovine, horse, human, pig, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... FOXL1(2300)

General description

The Forkhead Box L1 (FoxL1) is a transcription factor that modulates epithelial growth and gastrointestinal development. This transcription factor has been implicated in pancreatic and gastrointestinal carcinogenesis and can also function as prognostic biomarker for clear cell renal cell carcinoma. Studies in mce have also revealed that FoxL1 can function as a biological marker of the hepatic progenitor cells.
Rabbit Anti-FOXL1 antibody recognizes canine, human, and mouse FOXL1.

Immunogen

Synthetic peptide directed towards the N terminal region of human FOXL1

Application

Rabbit Anti-FOXL1 antibody can be used for western blot (2.5μg/ml) and IHC (4-8μg/ml) assays.

Biochem/physiol Actions

FOXL1 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.

Sequence

Synthetic peptide located within the following region: HLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPPY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Elija entre una de las versiones más recientes:

Certificados de análisis (COA)

Lot/Batch Number

¿No ve la versión correcta?

Si necesita una versión concreta, puede buscar un certificado específico por el número de lote.

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

Feng-Qiang Yang et al.
International journal of clinical and experimental pathology, 7(1), 110-122 (2014-01-16)
The Forkhead Box L1 (Foxl1) transcription factor regulates epithelial proliferation and development of gastrointestinal tract, and has been implicated in gastrointestinal and pancreatic tumorigenesis. However, the role of Foxl1 in renal cancer development and progression remains to be elucidated. The
Sara D Sackett et al.
Hepatology (Baltimore, Md.), 49(3), 920-929 (2008-12-24)
The liver contains a population of small bipotential facultative progenitor cells that reconstitute liver function when mature hepatocytes or cholangiocytes are unable to proliferate. Mesenchymal markers, including members of the forkhead transcription factor gene family, have been detected in hepatic

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico