Saltar al contenido
Merck
Todas las fotos(2)

Documentos clave

AV31085

Sigma-Aldrich

Anti-ELF1 (AB2) antibody produced in rabbit

affinity isolated antibody

Sinónimos:

Anti-E74-like factor 1 (ets domain transcription factor)

Iniciar sesiónpara Ver la Fijación de precios por contrato y de la organización


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

67 kDa

species reactivity

rat, bovine, dog, human, guinea pig, rabbit, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... ELF1(1997)

General description

ELF1 is known to function as a transcription factor that regulates the Tie2 gene during blood vessel development. Elf1 has also been implicated in the regulation of terminal transferase gene.
Rabbit Anti-ELF1 (AB2) antibody recognizes rat, human, bovine, canine, and mouse ELF1.

Immunogen

Synthetic peptide directed towards the N terminal region of human ELF1

Application

Rabbit Anti-ELF1 (AB2) antibody is suitable for use in western blot (1μg/ml) applications.

Biochem/physiol Actions

ELF1 belongs to the ETS family. It contains 1 ETS DNA-binding domain. ELF1 is a transcription factor that activates the LYN and BLK promoters. It appears to be required for the T-cell-receptor-mediated trans activation of HIV-2 gene expression. ELF1 binds specifically to two purine-rich motifs in the HIV-2 enhancer.

Sequence

Synthetic peptide located within the following region: VTLDGIPEVMETQQVQEKYADSPGASSPEQPKRKKGRKTKPPRPDSPATT

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

¿No encuentra el producto adecuado?  

Pruebe nuestro Herramienta de selección de productos.

Storage Class

10 - Combustible liquids

wgk_germany

WGK 3

flash_point_f

Not applicable

flash_point_c

Not applicable


Certificados de análisis (COA)

Busque Certificados de análisis (COA) introduciendo el número de lote del producto. Los números de lote se encuentran en la etiqueta del producto después de las palabras «Lot» o «Batch»

¿Ya tiene este producto?

Encuentre la documentación para los productos que ha comprado recientemente en la Biblioteca de documentos.

Visite la Librería de documentos

A Dube et al.
Circulation research, 88(2), 237-244 (2001-02-07)
Vascular development requires the tightly coordinated expression of several growth factors and their receptors. Among these are the Tie1 and Tie2 receptors, which are almost exclusively endothelial cell-specific. The critical transcriptional regulators of vascular-specific gene expression remain largely unknown. The
P Ernst et al.
Molecular and cellular biology, 16(11), 6121-6131 (1996-11-01)
The terminal deoxynucleotidyltransferase (TdT) gene represents an attractive model for the analysis of gene regulation during an early phase of lymphocyte development. In previous studies, we identified a DNA element, termed D', which is essential for TdT promoter activity in
Young-Rak Cho et al.
Oncology reports, 32(4), 1531-1536 (2014-08-12)
Broussonetia kazinoki (BK) has been used as a traditional medicine to improve vision, as well as for inflammatory and infectious diseases. In the present study, we investigated the effects and molecular mechanism of the ethanolic extract of BK on cell

Nuestro equipo de científicos tiene experiencia en todas las áreas de investigación: Ciencias de la vida, Ciencia de los materiales, Síntesis química, Cromatografía, Analítica y muchas otras.

Póngase en contacto con el Servicio técnico