SAB1402411

Monoclonal Anti-IL1R2 antibody produced in mouse

clone 1G12, purified immunoglobulin, buffered aqueous solution

• Synonym(s): CD121b, IL1RB, MGC47725
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• Quality Level: 100
• conjugate: unconjugated
• antibody form: purified immunoglobulin
• antibody product type: primary antibodies
• clone: 1G12, monoclonal
• form: buffered aqueous solution
• mol wt: antigen ~37.11 kDa
• species reactivity: human
• technique(s): capture ELISA: suitable; indirect ELISA: suitable; proximity ligation assay: suitable; western blot: 1-5 μg/mL
• isotype: IgG2aκ
• NCBI accession no.: NM_004633
• UniProt accession no.: P27930
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... IL1R2(7850)

Description

General description

The protein encoded by this gene is a cytokine receptor that belongs to the interleukin 1 receptor family. This protein binds interleukin alpha (IL1A), interleukin beta (IL1B), and interleukin 1 receptor, type I(IL1R1/IL1RA), and acts as a decoy receptor that inhibits the activity of its ligands. Interleukin 4 (IL4) is reported to antagonize the activity of interleukin 1 by inducing the expression and release of this cytokine. This gene and three other genes form a cytokine receptor gene cluster on chromosome 2q12. Two alternatively spliced transcript variants encoding the same protein have been reported. (provided by RefSeq)

Immunogen

IL1R2 (NP_004624, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWASVSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS

Physical form

Solution in phosphate buffered saline, pH 7.4

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable