Skip to Content
Merck
All Photos(1)

Key Documents

AV40735

Sigma-Aldrich

Anti-PRPF6 (AB2) antibody produced in rabbit

IgG fraction of antiserum

Synonym(s):

Anti-ANT-1, Anti-PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae), Anti-TOM

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

IgG fraction of antiserum

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

104 kDa

species reactivity

dog, guinea pig, human, bovine, rabbit, mouse, rat, horse

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PRPF6(24148)

General description

PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae) (PRPF6) is involved in pre-mRNA spliceosome assembly by acting as a link between small nuclear ribonucleoproteins (snRNP) U5 snRNP and U4/U6 snRNP to form U4/U6-U5 tri-snPNP. Mutation of PRPF6 are linked to impairment of pre-mRNA splicing and autosomal-dominant retinitis pigmentosa.

Specificity

Anti-PRPF6 (AB2) polyclonal antibody reacts with bovine, human, mouse, rat, zebrafish, and canine PRP6 pre-mRNA processing factor 6 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human PRPF6

Application

Anti-PRPF6 (AB2) polyclonal antibody is used to tag PRP6 pre-mRNA processing factor 6 homolog for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of PRP6 pre-mRNA processing factor 6 homolog in spliceosome assembly and autosomal-dominant retinitis pigmentosa.

Biochem/physiol Actions

PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.The protein encoded by this gene appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. The encoded protein also can bind androgen receptor, providing a link between transcriptional activation and splicing.

Sequence

Synthetic peptide located within the following region: PGKRTVGDQMKKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Sylvie Bannwarth et al.
Brain : a journal of neurology, 137(Pt 8), 2329-2345 (2014-06-18)
Mitochondrial DNA instability disorders are responsible for a large clinical spectrum, among which amyotrophic lateral sclerosis-like symptoms and frontotemporal dementia are extremely rare. We report a large family with a late-onset phenotype including motor neuron disease, cognitive decline resembling frontotemporal

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service