AV32564

Anti-FOXP1 antibody produced in rabbit

IgG fraction of antiserum

• Synonym(s): Anti-Forkhead box P1
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: rabbit
• Quality Level: 100
• conjugate: unconjugated
• antibody form: IgG fraction of antiserum
• antibody product type: primary antibodies
• clone: polyclonal
• form: buffered aqueous solution
• mol wt: 75 kDa
• species reactivity: horse, mouse, human, rabbit, rat, guinea pig
• concentration: 0.5 mg - 1 mg/mL
• technique(s): immunohistochemistry: suitable; western blot: suitable
• NCBI accession no.: NP_116071
• UniProt accession no.: Q9H334
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... FOXP1(27086)

Description

General description

FOXP1 is a transcription regulator that is expressed in B cells. High levels of FOXP1 expression have been associated with poor prognosis in patients with diffuse large B-cell lymphomas (DLBCLs). Chromosomal aberrations in FOXP1 gene have been linked to mucosa-associated lymphoid tissue (MALT) lymphoma.
Rabbit Anti-FOXP1 antibody recognizes bovine, canine, chicken, human, mouse, and rat FOXP1.

Immunogen

Synthetic peptide directed towards the N terminal region of human FOXP1

Application

Rabbit Anti-FOXP1 antibody can be used for IHC (4-8μg/ml) and western blotting (0.5μg/ml) applications.

Biochem/physiol Actions

FOXP1 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Forkhead box P1 protein contains both DNA-binding- and protein-protein binding-domains. This gene may act as a tumor suppressor as it is lost in several tumor types and maps to a chromosomal region (3p14.1) reported to contain a tumor suppressor gene(s).

Sequence

Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point(F): Not applicable
• Flash Point(C): Not applicable