Skip to Content
Merck
All Photos(2)

Key Documents

AV34484

Sigma-Aldrich

Anti-SMARCA2 antibody produced in rabbit

affinity isolated antibody

Sign Into View Organizational & Contract Pricing


About This Item

MDL number:
UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

32 kDa

species reactivity

mouse, rabbit, horse, bovine, human, dog, guinea pig, rat

concentration

0.5 mg - 1 mg/mL

technique(s)

immunohistochemistry: suitable
western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... SMARCA2(6595)

General description

SWItch/Sucrose Non-Fermentable (SWI/SNF)-related matrix-associated actin-dependent regulator of chromatin subfamily A member 2 (SMARCA2) is a member of the SWI/SNF family of proteins and is highly like the Brahma protein of Drosophila. Two transcript variants encoding different isoforms have been found for this gene, which contains a trinucleotide repeat (CAG) length polymorphism.

Immunogen

Synthetic peptide directed towards the middle region of human SMARCA2

Application

Rabbit Anti-SMARCA2 can be used for western blot applications at a concentration of 0.5 μg/ml. It can also be used for IHC applications at 4-8 μg/ml.

Biochem/physiol Actions

SMARCA2 protein is a part of the large adenosine triphosphate (ATP)-dependent chromatin remodeling complex SWItch/sucrose non-fermentable (SWI/SNF), which is required for transcriptional activation of genes normally repressed by chromatin. Members of SWI/SNF family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes.

Sequence

Synthetic peptide located within the following region: VINYKDSSGRQLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKY

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Certificates of Analysis (COA)

Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Minori Koga et al.
Human molecular genetics, 18(13), 2483-2494 (2009-04-14)
Chromatin remodeling may play a role in the neurobiology of schizophrenia and the process, therefore, may be considered as a therapeutic target. The SMARCA2 gene encodes BRM in the SWI/SNF chromatin-remodeling complex, and associations of single nucleotide polymorphisms (SNPs) to
Jeroen K J Van Houdt et al.
Nature genetics, 44(4), 445-449 (2012-03-01)
Nicolaides-Baraitser syndrome (NBS) is characterized by sparse hair, distinctive facial morphology, distal-limb anomalies and intellectual disability. We sequenced the exomes of ten individuals with NBS and identified heterozygous variants in SMARCA2 in eight of them. Extended molecular screening identified nonsynonymous

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service