WH0001841M1
Monoclonal Anti-DTYMK antibody produced in mouse
clone 2C2, ascites fluid
Synonym(s):
Anti-CDC8, Anti-TMPK, Anti-TYMK, Anti-deoxythymidylate kinase (thymidylate kinase)
About This Item
Related Categories
1 of 4
This Item | SAB1405733 | SAB1410310 | HPA042593 |
---|---|---|---|
unconjugated | unconjugated | unconjugated | unconjugated |
2C2, monoclonal | polyclonal | polyclonal | polyclonal |
mouse | mouse | rabbit | rabbit |
human | human | human | human |
ascites fluid | purified immunoglobulin | purified immunoglobulin | affinity isolated antibody |
Immunogen
Sequence
VAFTGAKENFSLDWCKQPDVGLPKPDLVLFLQLQLADAAKRGAFGHERYENGAFQERALRCFHQLMKDTTLNWKMVDASKSIEAVHEDIRVLSEDAIRTATEKPLGELWK
Physical form
Legal Information
Not finding the right product?
Try our Product Selector Tool.
Storage Class Code
10 - Combustible liquids
Flash Point(F)
Not applicable
Flash Point(C)
Not applicable
Personal Protective Equipment
Choose from one of the most recent versions:
Certificates of Analysis (COA)
Don't see the Right Version?
If you require a particular version, you can look up a specific certificate by the Lot or Batch number.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service