SAB5702316

Anti-Cofilin Antibody, clone 4M1Z9, Rabbit Monoclonal

• Synonym(s): CFL1, CFL, HEL-S-15, cofilin, cofilin-1
• UNSPSC Code: 12352203

Properties

• biological source: rabbit
• Quality Level: 100
• material: colorless
• clone: 4M1Z9, monoclonal
• form: liquid
• mol wt: 18 kDa
• species reactivity: rat, human, rat
• concentration: 1.5 mg/mL
• technique(s): western blot: 1:500 - 1:2000
• color: colorless
• isotype: IgG
• immunogen sequence: MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLV
• UniProt accession no.: P23528
• shipped in: wet ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... Cofilin(1072)

Description

General description

The protein encoded by this gene can polymerize and depolymerize F-actin and G-actin in a pH-dependent manner. Increased phosphorylation of this protein by LIM kinase aids in Rho-induced reorganization of the actin cytoskeleton. Cofilin is a widely distributed intracellular actin-modulating protein that binds and depolymerizes filamentous F-actin and inhibits the polymerization of monomeric G-actin in a pH-dependent manner. It is involved in the translocation of actin-cofilin complex from cytoplasm to nucleus.[supplied by OMIM, Apr 2004]

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Cofilin (P23528).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Safety Information

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1