MSST0060
SILu™Lite CST3, Cystatin C human
recombinant, expressed in E. coli, MS Protein Standard
Synonym(s):
CST3, Cystatin C
Sign Into View Organizational & Contract Pricing
All Photos(1)
About This Item
Recommended Products
recombinant
expressed in E. coli
Quality Level
Assay
≥95% (SDS-PAGE)
form
lyophilized powder
suitability
suitable for mass spectrometry (internal calibrator)
UniProt accession no.
shipped in
ambient
storage temp.
−20°C
Gene Information
human ... CST3(1471)
Related Categories
General description
SILu™Lite CST3 is a recombinant human protein expressed in E. coli. It consists of 120 amino acids, with a calculated molecular mass of 13.5 kDa. SILu™Lite CST3 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.
Biochem/physiol Actions
Cystatin C is an inhibitor of cysteine proteases including cathepsin B (which has been identified as the most important ?-amyloid-degrading enzyme. Measurement of cystatin C in serum is replacing creatinine as an indicator of kidney function (glomerular filtration rate, GFR).
Sequence
SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Physical form
Supplied as a lyophilized powder containing tris buffered saline and methionine.
Legal Information
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class Code
11 - Combustible Solids
WGK
WGK 2
Certificates of Analysis (COA)
Search for Certificates of Analysis (COA) by entering the products Lot/Batch Number. Lot and Batch Numbers can be found on a product’s label following the words ‘Lot’ or ‘Batch’.
Already Own This Product?
Find documentation for the products that you have recently purchased in the Document Library.
Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.
Contact Technical Service