WH0256297M5

Monoclonal Anti-PTF1A antibody produced in mouse

clone 1A2, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-PTF1p48, Anti-pancreas specific transcription factor, 1a
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1A2, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2a
• GenBank 수납 번호: NM_178161
• UniProt 수납 번호: Q7RTS3
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PTF1A(256297)

설명

일반 설명

This gene encodes a protein that is a component of the pancreas transcription factor 1 complex (PTF1) and is known to have a role in mammalian pancreatic development. The protein plays a role in determining whether cells allocated to the pancreatic buds continue towards pancreatic organogenesis or revert back to duodenal fates. The protein is thought to be involved in the maintenance of exocrine pancreas-specific gene expression including elastase 1 and amylase. Mutations in this gene cause cerebellar agenesis and loss of expression is seen in ductal type pancreas cancers. (provided by RefSeq)

면역원

PTF1A (NP_835455, 250 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSSFNNIENEPPFEFVS

생화학적/생리학적 작용

Pancreas specific transcription factor, 1A (PTF1A) aids in the growth and differentiation of pancreas. It also has a control over excitatory and inhibitory neurons in the brain. Mutations in the PTF1A gene have been linked to cerebellar agenesis.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)