WH0057534M3

Monoclonal Anti-MIB1 antibody produced in mouse

clone 2A9, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-DIP1, Anti-DKFZp686I0769, Anti-DKFZp761M1710, Anti-FLJ90676, Anti-MGC129659, Anti-MGC129660, Anti-MIB, Anti-ZZANK2, Anti-ZZZ6, Anti-mindbomb homolog 1 (Drosophila)
• MDL number: MFCD03791502
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2A9, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG2aκ
• GenBank 수납 번호: NM_020774
• UniProt 수납 번호: Q86YT6
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MIB1(57534)

설명

면역원

MIB1 (NP_065825, 909 a.a. ~ 1006 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PFIMCCGGKSSEDATDDISSGNIPVLQKDKDNTNVNADVQKLQQQLQDIKEQTMCPVCLDRLKNMIFLCGHGTCQLCGDRMSECPICRKAIERRILLY

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)