WH0010912M1

Monoclonal Anti-GADD45G antibody produced in mouse

clone 1D3, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-CR6, Anti-DDIT2, Anti-GADD45gamma, Anti-GRP17, Anti-growth arrest and DNA-damage-inducible, gamma
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1D3, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: BC019325
• UniProt 수납 번호: O95257
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... GADD45G(10912)

설명

일반 설명

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. (provided by RefSeq)

면역원

GADD45G (AAH19325, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE

생화학적/생리학적 작용

GADD45G (growth arrest and DNA-damage-inducible, γ) gene encodes a protein that is expressed in increased levels under stress, growth arrest conditions and treatment with DNA-damaging agents such as UV (ultraviolet) and γ-irradiation. It mediates activation of MTK1/MEKK4 kinase (mitogen-activated protein kinase kinase kinase 4) upon environmental stress, which in turn activates p38 and JNK MAPK (c-Jun N-terminal kinase/ mitogen-activated protein kinase) pathways that regulate cell cycle and apoptosis. The encoded protein functions in DNA repair, negative growth control, genomic stability, cell cycle checkpoints and apoptosis.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)