생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
3A4, monoclonal
형태
buffered aqueous solution
종 반응성
human
기술
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... FTCD(10841)
일반 설명
FTCD is a bifunctional enzyme that channels 1-carbon units from formiminoglutamate, a metabolite of the histidine degradation pathway, to the folate pool.(supplied by OMIM) Formimidoyltransferase cyclodeaminase (FTCD) gene is localized in human fetal and adult liver. The gene is located on human chromosome 21q22.3.
면역원
FTCD (NP_996848, 440 a.a. ~ 541 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
Sequence
LQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE
애플리케이션
Monoclonal Anti-FTCD antibody produced in mouse has been used in indirect immunofluorescence staining, immunohistochemistry and immunocytochemistry.
생화학적/생리학적 작용
Formimidoyltransferase cyclodeaminase (FTCD) deficiency is associated with formiminoglutamic aciduria. FTCD is considered as a therapeutic target for hepatocellular carcinoma (HCC). Mutations in FTCD is linked to glutamate formiminotransferase deficiency.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Alteration of poly (ADP-ribose) glycohydrolase nucleocytoplasmic shuttling characteristics upon cleavage by apoptotic proteases
Biology of the Cell, 95(9), 635-644 (2003)
Allelic spectrum of formiminotransferase-cyclodeaminase gene variants in individuals with formiminoglutamic aciduria
Molecular Genetics & Genomic Medicine, 5(6), 795-799 (2017)
Cloning and characterization of human FTCD on 21q22. 3, a candidate gene for glutamate formiminotransferase deficiency
Cytogenetic and genome research, 88(1-2), 43-49 (2000)
Differential intracellular trafficking of von Willebrand factor (vWF) and vWF propeptide in porcine endothelial cells lacking Weibel-Palade bodies and in human endothelial cells
Atherosclerosis, 167(1), 55-63 (2003)
Using a yeast two-hybrid system to identify FTCD as a new regulator for HIF-1alpha in HepG2 cells
Cellular Signalling, 26(7), 1560-1566 (2014)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.