WH0010146M1

Monoclonal Anti-G3BP antibody produced in mouse

clone 2F3, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-HDHVIII, Anti-Ras-GTPase-activating protein SH3-domain-binding protein
• MDL number: MFCD02262927
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2F3, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: ELISA: suitable; capture ELISA: suitable; immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: BC006997
• UniProt 수납 번호: Q13283
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... G3BP1(10146)

설명

일반 설명

G3BP1 (Ras-GTPase-activating protein SH3 domain-binding protein 1) is a constituent of stress granules. It is located on human chromosome 5q14.2-5q33.3.

면역원

G3BP (AAH06997, 214 a.a. ~ 303 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRV

생화학적/생리학적 작용

G3BP1 (Ras-GTPase-activating protein SH3 domain-binding protein 1) blocks the replication of HIV-1 (human immunodeficiency virus) in macrophages and T-cells. In gastric cancer patients, overexpression of G3BP1 leads to imperfect clinical predictions. It is crucial for the interactions of SG–PB (stress granule-processing bodies).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)