WH0009402M1

Monoclonal Anti-GRAP2 antibody produced in mouse

clone 1G12, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-GADS, Anti-GRAP2, Anti-GRB2-related adaptor protein 2, Anti-GRB2L, Anti-GRBLG, Anti-GRID, Anti-GRPL, Anti-GrbX, Anti-Grf40, Anti-Mona, Anti-P38
• MDL number: MFCD03455450
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1G12, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; immunoprecipitation (IP): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: BC025692
• UniProt 수납 번호: O75791
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... GRAP2(9402)

설명

일반 설명

This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist. (provided by RefSeq)

면역원

GRAP2 (AAH25692, 226 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHN

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)