콘텐츠로 건너뛰기
Merck
모든 사진(1)

Key Documents

WH0007267M9

Sigma-Aldrich

Monoclonal Anti-TTC3 antibody produced in mouse

clone 2D10, purified immunoglobulin, buffered aqueous solution

동의어(들):

Anti-DCRR1, Anti-DKFZp686M0150, Anti-RNF105, Anti-TPRDIII, Anti-tetratricopeptide repeat domain 3

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

mouse

결합

unconjugated

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

2D10, monoclonal

형태

buffered aqueous solution

종 반응성

human

기술

indirect ELISA: suitable

동형

IgG2aκ

GenBank 수납 번호

UniProt 수납 번호

배송 상태

dry ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... TTC3(7267)

일반 설명

TTCR (tetratricopeptide repeat protein 3) is one of the main genes present within the Down syndrome critical region (DSCR) on human chromosome 21q22.2. The encoded protein is an E3 ubiquitin liase, composed of 2025 amino acids, and its N-terminal contains three tetratricopeptide repeat (TPR) motifs. It also contains a RING (really interesting new gene) finger motif, a putative Akt phosphorylation site, and nuclear localization signals.

면역원

TTC3 (NP_003307, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MDNFAEGDFTVADYALLEDCPHVDDCVFAAEFMSNDYVRVTQLYCDGVGVQYKDYIQSERNLEFDICSIWCSKPISVLQDYCDAIKINIFWPLLFQHQNSSVISRLHPCV

생화학적/생리학적 작용

TTCR (tetratricopeptide repeat protein 3) interacts with phosphorylated Akt protein, and promotes its ubiquitination and degradation in the nucleus. The expression of TTCR is increased in Down syndrome (DS) cells, and its interaction with Akt protein is thought to be responsible for the clinical symptoms of DS. TTC3-RhoA-CIT-K (citron kinase) pathway is thought to play a key role in neuronal development, and its hyperactivity might result in disruption of normal differentiation.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Gaia Berto et al.
Journal of cell science, 120(Pt 11), 1859-1867 (2007-05-10)
The Down syndrome critical region (DSCR) on Chromosome 21 contains many genes whose duplication may lead to the major phenotypic features of Down syndrome and especially the associated mental retardation. However, the functions of DSCR genes are mostly unknown and
Futoshi Suizu et al.
Developmental cell, 17(6), 800-810 (2010-01-12)
The serine threonine kinase Akt is a core survival factor that underlies a variety of human diseases. Although regulatory phosphorylation and dephosphorylation have been well documented, the other posttranslational mechanisms that modulate Akt activity remain unclear. We show here that

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.