WH0006938M1

Monoclonal Anti-TCF12 antibody produced in mouse

clone 2E9, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-HEB, Anti-HTF4, Anti-HsT17266, Anti-transcription factor 12 (HTF4, helix-loop-helix transcription factors 4)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2E9, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: NM_207036
• UniProt 수납 번호: Q99081
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TCF12(6938)

설명

일반 설명

The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH) E-protein family that recognizes the consensus binding site (E-box) CANNTG. This encoded protein is expressed in many tissues, among them skeletal muscle, thymus, B- and T-cells, and may participate in regulating lineage-specific gene expression through the formation of heterodimers with other bHLH E-proteins. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. (provided by RefSeq)

면역원

TCF12 (NP_996919, 364 a.a. ~ 453 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VGSPSPLTGTSQWPRPGGQAPSSPSYENSLHSLKNRVEQQLHEHLQDAMSFLKDVCEQSRMEDRLDRLDDAIHVLRNHAVGPSTSLPAGH

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)