WH0006662M2

Monoclonal Anti-SOX9 antibody produced in mouse

clone 3C10, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-CMD1, Anti-CMPD1, Anti-SRA1, Anti-SRY (sex determining region Y)-box 9 (campomelic dysplasia, autosomal sex-reversal)
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3C10, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: NM_000346
• UniProt 수납 번호: P48436
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SOX9(6662)

설명

일반 설명

The protein encoded by this gene recognizes the sequence CCTTGAG along with other members of the HMG-box class DNA-binding proteins. It acts during chondrocyte differentiation and, with steroidogenic factor 1, regulates transcription of the anti-Muellerian hormone (AMH) gene. Deficiencies lead to the skeletal malformation syndrome campomelic dysplasia, frequently with sex reversal. (provided by RefSeq)

면역원

SOX9 (NP_000337, 400 a.a. ~ 509 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EQLSPSHYSEQQQHSPQQIAYSPFNLPHYSPSYPPITRSQYDYTDHQNSSSYYSHAAGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQLTRP

애플리케이션

Monoclonal Anti-SOX9 antibody produced in mouse has been used in immunofluorescence.

생화학적/생리학적 작용

Sex determining region Y-box 9 (SOX9), a transcription factor, is associated with the testis-determining factor sex determining region Y (SRY). It is expressed mainly in adult tissues and also in fetal testis and skeletal tissue. SOX9 consists of two functional domains: a high-mobility group (HMG) DNA-binding domain and a C-terminal transactivation domain. It plays a major role in cartilage differentiation and early testis development. It has been reported that SOX9 might play a role in chondrogenesis. Mutation of SOX9 gene in human causes campomelic dysplasia, a severe dwarfism syndrome and autosomal XY sex reversal.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)