WH0005728M1
Monoclonal Anti-PTEN antibody produced in mouse
clone 2G9, purified immunoglobulin, buffered aqueous solution
동의어(들):
Anti-BZS, Anti-MGC11227, Anti-MHAM, Anti-MMAC1, Anti-PTEN1, Anti-TEP1, Anti-phosphatase and tensin homolog (mutated in multiple advanced cancers 1)
로그인조직 및 계약 가격 보기
모든 사진(4)
About This Item
추천 제품
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
2G9, monoclonal
형태
buffered aqueous solution
종 반응성
human
기술
indirect ELISA: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PTEN(5728)
일반 설명
Phosphatase and tensin homolog (PTEN) is a tumor-suppressor gene. It encodes for a phosphatase which possesses a tensin-like domain, a catalytic domain and a 220-amino acid carboxy-terminal region. The PTEN gene is localized on human chromosome 10q23.3.
면역원
PTEN (AAH05821, 221 a.a. ~ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL
Sequence
KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTL
애플리케이션
Monoclonal Anti-PTEN antibody produced in mouse has been used in Western Blotting.
생화학적/생리학적 작용
Phosphatase and tensin homolog (PTEN) is a negative regulator of the phosphoinositide 3-kinase (PI3K) pathway. It de-phosphorylates phosphatidylinositol-[3, 4, 5]-tri-phosphate (PIP3). PTEN also has roles in cell growth, proliferation, control of cell cycle and apoptosis. It has been associated with gastric and breast cancers.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Phosphatase and tensin homolog (PTEN) is down-regulated in human NK/T-cell lymphoma and corrects with clinical outcomes.
Medicine (2017)
PTEN Gene Induces Cell Invasion and Migration via Regulating AKT/GSK-3?/?-Catenin Signaling Pathway in Human Gastric Cancer.
Ma J.al
Digestive Diseases and Sciences (2017)
Reduced PTEN involved in primary immune thrombocytopenia via contributing to B cell hyper-responsiveness.
Wang S
Molecular Immunology (2018)
Modulation of YY1 and p53 expression by transforming growth factor-?3 in prostate cell line
Caggia, Silvia, et al
Cytokine, 403-410 (2011)
Deregulation of PTEN Expression in Laryngeal Squamous Cell Carcinoma Based on Tissue Microarray Digital Analysis.
Mastronikolis NS
Anticancer Research (2017)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.