추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
1D12, monoclonal
양식
buffered aqueous solution
종 반응성
mouse, human, rat
기술
indirect ELISA: suitable
indirect immunofluorescence: suitable
proximity ligation assay: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... PML(5371)
일반 설명
Promyelocytic leukemia (PML) is a 70 KDa protein, made of 560 amino acids.
PML is present in the nucleus. It has 9 coding exons and is mapped to human chromosome 15q24.
PML is present in the nucleus. It has 9 coding exons and is mapped to human chromosome 15q24.
면역원
PML (AAH00080, 411 a.a. ~ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV
Sequence
RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV
생화학적/생리학적 작용
Promyelocytic leukemia (PML) helps in the complete formation of the nuclear body. It can serve as a transcriptional cofactor. PML plays major roles in modulating cell morphology, proliferation and migration. It has the capability to block the ubiquitination and proteasomal degradation processes. Cytoplasmic PML is required to control TGF-β1 (transforming growth factor β 1) signaling.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
시험 성적서(COA)
Lot/Batch Number
Promyelocytic leukemia (PML) protein plays important roles in regulating cell adhesion, morphology, proliferation and migration.
Tang M K, et al.
PLoS ONE, 8(3), e59477-e59477 (2013)
PML (promyelocytic leukemia).
Viguie F
Atlas of Genetics and Cytogenetics in Oncology and Haematology (2000)
The transcriptional role of PML and the nuclear body.
Zhong S, et al.
Nature Cell Biology, 2(5), E85-E85 (2000)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.