WH0005111M2

Monoclonal Anti-PCNA antibody produced in mouse

clone 1G7, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-MGC8367, Anti-proliferating cell nuclear antigen
• MDL number: MFCD00213036
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1G7, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: immunoprecipitation (IP): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: BC000491
• UniProt 수납 번호: P12004
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PCNA(5111)

설명

일반 설명

Proliferating cell nuclear antigen (PCNA) is a ring-shaped homotrimer protein that is located at the center of the faithful duplication of eukaryotic genomes. Since it encircles the DNA, PCNA is also known as a sliding clamp. This gene is mapped to human chromosome 20p12.3.

The protein encoded by this gene is found in the nucleus and is a cofactor of DNA polymerase delta. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. In response to DNA damage, this protein is ubiquitinated and is involved in the RAD6-dependent DNA repair pathway. Two transcript variants encoding the same protein have been found for this gene. Pseudogenes of this gene have been described on chromosome 4 and on the X chromosome. (provided by RefSeq)

면역원

PCNA (AAH00491, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS

애플리케이션

Monoclonal Anti-PCNA antibody has been used in immunocytochemistry and western blotting.

생화학적/생리학적 작용

Proliferating cell nuclear antigen (PCNA) controls the production of the leading and lagging strands, that are required for the duplication of DNA. It acts as a cell cycle regulatory protein. This protein regulates apoptosis. PCNA is also involved in non-replicative DNA synthesis events.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)